PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID EMT28630
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Aegilops
Family MYB_related
Protein Properties Length: 241aa    MW: 26664.9 Da    PI: 11.4034
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
EMT28630genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding42.71.3e-13165209347
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      +WT+ E+ l++ + k++G g+W+ I+r + ++Rt+ q+ s+ qky
         EMT28630 165 PWTEHEHRLFLLGLKKYGRGDWRNISRNFVQTRTPTQVASHAQKY 209
                      8*******************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF813831.21E-962143IPR001810F-box domain
PfamPF006462.8E-463101IPR001810F-box domain
Gene3DG3DSA:1.20.1280.502.3E-864111No hitNo description
PROSITE profilePS5129417.151158214IPR017930Myb domain
SuperFamilySSF466899.72E-17160214IPR009057Homeodomain-like
TIGRFAMsTIGR015572.2E-16162212IPR006447Myb domain, plants
SMARTSM007171.2E-11162212IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.603.8E-11164208IPR009057Homeodomain-like
PfamPF002491.7E-10165209IPR001005SANT/Myb domain
CDDcd001671.10E-10165210No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 241 aa     Download sequence    Send to blast
MKCPSDSSAG RDPWAPPPAS GGGGSSEPAK KRQRTSSSSQ AEASSSSSQP PPQQPGDARE  60
VPDLGEDVMF EVRRRVEPRT LAAAACVSQG WRGLAQDERL WEAPCVRERT GLGFSEQLLR  120
AVVLPFGGFR RLHAVSIQAR RRFGVGCGNW HGVRTPERGR RRGVPWTEHE HRLFLLGLKK  180
YGRGDWRNIS RNFVQTRTPT QVASHAQKYF IRLSSGVARR SSIHDITTVH LTDDQPPAPS  240
Q
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankJF9519540.0JF951954.1 Aegilops tauschii clone TaMYB71 MYB-related protein mRNA, complete cds.
GenBankKU8570380.0KU857038.1 Triticum aestivum GID2 protein isoform 3 (gid2) mRNA, complete cds.
GenBankKU8570430.0KU857043.1 Aegilops tauschii GID2 protein (gid2) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
TrEMBLM8BUC91e-176M8BUC9_AEGTA; F-box protein GID2
STRINGMLOC_79329.27e-80(Hordeum vulgare)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP1245133
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G58900.16e-38Homeodomain-like transcriptional regulator